CD51 (ITGAV) Rabbit Polyclonal Antibody

SKU TA338302

Rabbit Polyclonal Anti-ITGAV Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human, Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ITGAV antibody is: synthetic peptide directed towards the C-terminal region of Human ITGAV. Synthetic peptide located within the following region: PVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 100 kDa
• Gene Name: integrin subunit alpha V
• Database Link:
  NP_001138471
  P06756
• Background: ITAGV encodes integrin alpha chain V. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. The I-domain containing integrin alpha V undergoes post-translational cleavage to yield disulfide-linked heavy and light chains, that combine with multiple integrin beta chains to form different integrins. Among the known associating beta chains (beta chains 1,3,5,6, and 8; 'ITGB1', 'ITGB3', 'ITGB5', 'ITGB6', and 'ITGB8'), each can interact with extracellular matrix ligands; the alpha V beta 3 integrin, perhaps the most studied of these, is referred to as the Vitronectin receptor (VNR). In addition to adhesion, many integrins are known to facilitate signal transduction. Alternative splicing results in multiple transcript variants.
• Synonyms: CD51; MSK8; VNRA; VTNR
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Transmembrane
• Protein Pathways: Arrhythmogenic right ventricular cardiomyopathy (ARVC), Cell adhesion molecules (CAMs), Dilated cardiomyopathy, ECM-receptor interaction, Focal adhesion, Hypertrophic cardiomyopathy (HCM), Pathways in cancer, Regulation of actin cytoskeleton, Small cell lung cancer