PLXNB3 Rabbit Polyclonal Antibody

SKU TA338294

Rabbit Polyclonal Anti-PLXNB3 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PLXNB3 antibody is: synthetic peptide directed towards the C-terminal region of Human PLXNB3. Synthetic peptide located within the following region: DYRTYAERAFFPGHGGCPLQPKPEGPGEDGHCATVRQGLTQLSNLLNSKL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 171 kDa
• Gene Name: plexin B3
• Database Link:
  NP_001156729
  Q9ULL4
• Background: The protein encoded by this gene is a member of the plexin family. It functions as a receptor for semaphorin 5A, and plays a role in axon guidance, invasive growth and cell migration. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Synonyms: PLEXB3; PLEXR; PLXN6
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 83%; Guinea pig: 83%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Axon guidance