DRG2 Rabbit Polyclonal Antibody

SKU TA338274

Rabbit Polyclonal Anti-DRG2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DRG2 antibody is: synthetic peptide directed towards the N-terminal region of Human DRG2. Synthetic peptide located within the following region: MGILEKISEIEKEIARTQKNKATEYHLGLLKAKLAKYRAQLLEPSKSASS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 40 kDa
• Gene Name: developmentally regulated GTP binding protein 2
• Database Link:
  NP_001379
  P55039
• Background: This gene encodes a GTP-binding protein known to function in the regulation of cell growth and differentiation. Read-through transcripts containing this gene and a downstream gene have been identified, but they are not thought to encode a fusion protein. This gene is located within the Smith-Magenis syndrome region on chromosome 17.
• Synonyms: developmentally regulated GTP-binding protein 2; developmentally regulated GTP binding protein 2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data