OriGene Logo

IGFBP4 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA338268
Rabbit Polyclonal Anti-IGFBP4 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
2 Weeks*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY419861 Transient overexpression lysate of insulin-like growth factor binding protein 4 (IGFBP4) 100 ug
$436.00
TP304188 Recombinant protein of human insulin-like growth factor binding protein 4 (IGFBP4), 20 µg
20 ug
$867.00

View other "IGFBP4 or NM_001552" antibodies

Specifications
Specifications
Product Data
Application IHC, WB
Recommended Dilution WB, IHC
Reactivity Human, Mouse
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-IGFBP4 antibody: synthetic peptide directed towards the middle region of human IGFBP4. Synthetic peptide located within the following region: RALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCV
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 26 kDa
Gene Name insulin like growth factor binding protein 4
Database Link
Background This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma in both glycosylated and non-glycosylated forms. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors. provided by RefSeq, Jul 2008
Synonyms BP-4; HT29-IGFBP; IBP4; IGFBP-4
Note Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Guinea pig: 93%
Reference Data
Protein Categories Growth Factors, Secreated Proteins
Protein Families Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.