BAAT Rabbit Polyclonal Antibody

SKU TA338266

Rabbit Polyclonal Anti-BAAT Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-BAAT antibody: synthetic peptide directed towards the N terminal of human BAAT. Synthetic peptide located within the following region: IQLTATPVSALVDEPVHIRATGLIPFQMVSFQASLEDENGDMFYSQAHYR
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 46 kDa
• Gene Name: bile acid-CoA:amino acid N-acyltransferase
• Database Link:
  NP_001692
  Q14032
• Background: Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified. Plastin 1 (otherwise known as Fimbrin) is a third distinct plastin isoform which is specifically expressed at high levels in the small intestine. The L isoform is expressed only in hemopoietic cell lineages, while the T isoform has been found in all other normal cells of solid tissues that have replicative potential (fibroblasts, endothelial cells, epithelial cells, melanocytes, etc.). The C-terminal 570 amino acids of the T-plastin and L-plastin proteins are 83% identical. It contains a potential calcium-binding site near the N terminus. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Feb 2010]
• Synonyms: BACAT; BAT
• Note: Immunogen Sequence Homology: Horse: 100%; Human: 100%; Rabbit: 100%; Dog: 93%; Rat: 93%; Mouse: 93%; Pig: 86%; Bovine: 86%; Guinea pig: 86%

Reference Data

• Protein Pathways: Biosynthesis of unsaturated fatty acids, Metabolic pathways, Primary bile acid biosynthesis, Taurine and hypotaurine metabolism