UQCRC2 Rabbit Polyclonal Antibody

SKU TA338233

Rabbit Polyclonal Anti-UQCRC2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-UQCRC2 antibody is: synthetic peptide directed towards the C-terminal region of Human UQCRC2. Synthetic peptide located within the following region: GIYTISQATAAGDVIKAAYNQVKTIAQGNLSNTDVQAAKNKLKAGYLMSV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 47 kDa
• Gene Name: ubiquinol-cytochrome c reductase core protein II
• Database Link:
  NP_003357
  P22695
• Background: This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. The core protein 2 is required for the assembly of the complex.
• Synonyms: MC3DN5; QCR2; UQCR2
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Bovine: 93%; Rat: 86%; Goat: 86%; Horse: 86%; Mouse: 86%; Rabbit: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome, Protease
• Protein Pathways: Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease