ILF1 (FOXK2) Rabbit Polyclonal Antibody

SKU TA338185

Rabbit Polyclonal Anti-FOXK2 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FOXK2 antibody: synthetic peptide directed towards the middle region of human FOXK2. Synthetic peptide located within the following region: ANTYTVSGQAVVTPAAVLAPPKAEAQENGDHREVKVKVEPIPAIGHATLG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 69 kDa
• Gene Name: forkhead box K2
• Database Link:
  NP_004505
  Q01167
• Background: FOXK2 contains a fork head DNA binding domain. This protein can bind to the purine-rich motifs of the HIV long terminal repeat (LTR), and to the similar purine-rich motif in the interleukin 2 (IL2) promoter. It may be involved in the regulation of viral and cellular promoter elements. Three alternatively spliced transcript variants encoding distinct isoforms have been described.The protein encoded by this gene contains a fork head DNA binding domain. This protein can bind to the purine-rich motifs of the HIV long terminal repeat (LTR), and to the similar purine-rich motif in the interleukin 2 (IL2) promoter. It may be involved in the regulation of viral and cellular promoter elements. Three alternatively spliced transcript variants encoding distinct isoforms have been described.
• Synonyms: ILF; ILF-1; ILF1
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Rat: 91%; Mouse: 91%; Dog: 86%; Rabbit: 79%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors