Epiphycan (EPYC) Rabbit Polyclonal Antibody

SKU
TA338172
Rabbit Polyclonal Anti-EPYC Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-EPYC antibody is: synthetic peptide directed towards the middle region of Human EPYC. Synthetic peptide located within the following region: FYSRFNRIKKINKNDFASLSDLKRIDLTSNLISEIDEDAFRKLPQLRELV
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 35 kDa
Gene Name epiphycan
Database Link
Background Dermatan sulfate proteoglycan 3 is a member of the small leucine-rich repeat proteoglycan family. This gene is composed of seven exons. It regulates fibrillogenesis by interacting with collagen fibrils and other extracellular matrix proteins.
Synonyms DSPG3; Pg-Lb; PGLB; SLRR3B
Note Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Horse: 93%; Guinea pig: 93%
Reference Data
Protein Families Secreted Protein
Write Your Own Review
You're reviewing:Epiphycan (EPYC) Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.