SLC17A1 Rabbit Polyclonal Antibody

SKU TA338167

Rabbit Polyclonal Anti-SLC17A1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SLC17A1 antibody is: synthetic peptide directed towards the N-terminal region of Human SLC17A1. Synthetic peptide located within the following region: VHCCNVIITAQRACLNLTMVVMVNSTDPHGLPNTSTKKLLDNIKNPMYNW
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 22 kDa
• Gene Name: solute carrier family 17 member 1
• Database Link:
  NP_005065
  Q14916
• Background: The function of this protein remains unknown.
• Synonyms: NAPI-1; NPT-1; NPT1
• Note: Immunogen Sequence Homology: Horse: 100%; Human: 100%; Bovine: 85%; Dog: 83%; Pig: 77%

Reference Data

• Protein Families: Transmembrane