DPP2 (DPP7) Rabbit Polyclonal Antibody

SKU TA338099

Rabbit Polyclonal Anti-DPP7 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DPP7 antibody is: synthetic peptide directed towards the middle region of Human DPP7. Synthetic peptide located within the following region: FRQIKDLFLQGAYDTVRWEFGTCQPLSDEKDLTQLFMFARNAFTVLAMMD
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 52 kDa
• Gene Name: dipeptidyl peptidase 7
• Database Link:
  NP_037511
  Q9UHL4
• Background: The protein encoded by this gene is a post-proline cleaving aminopeptidase expressed in quiescent lymphocytes. The resting lymphocytes are maintained through suppression of apoptosis, a state which is disrupted by inhibition of this novel serine protease. The enzyme has strong sequence homology with prolylcarboxypeptidase and is active at both acidic and neutral pH.
• Synonyms: DPP2; DPPII; QPP
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 85%; Bovine: 85%

Reference Data

• Protein Families: Protease