Cog1 Rabbit Polyclonal Antibody

SKU TA338098

Rabbit Polyclonal Anti-Cog1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Cog1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Cog1. Synthetic peptide located within the following region: ENQIKKEGAFPMTQNRALQLLYDLRYLTMVLSSKGEEVKSGRSKADSRME
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 109 kDa
• Gene Name: component of oligomeric golgi complex 1
• Database Link:
  NP_038609
  Q9Z160
• Background: Cog1 is required for normal Golgi function.
• Synonyms: CDG2G; DKFZp762L1710; KIAA1381; LDLB
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 86%; Horse: 86%; Mouse: 86%; Rabbit: 86%; Dog: 83%; Rat: 79%

Reference Data