TRIM14 Rabbit Polyclonal Antibody

SKU TA338079

Rabbit Polyclonal Anti-TRIM14 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TRIM14 antibody: synthetic peptide directed towards the N terminal of human TRIM14. Synthetic peptide located within the following region: TELRLLLDEEEALAKKFIDKNTQLTLQVYREQADSCREQLDIMNDLSNRV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 50 kDa
• Gene Name: tripartite motif containing 14
• Database Link:
  NP_055603
  Q14142
• Background: The protein encoded byTRIM14 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies and its function has not been determined. Four alternatively spliced transcript variants for this gene have been described.The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies and its function has not been determined. Four alternatively spliced transcript variants for this gene have been described.
• Synonyms: KIAA0129
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Dog: 86%; Rabbit: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome