MAST1 Rabbit Polyclonal Antibody

SKU TA338071

Rabbit Polyclonal Anti-MAST1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MAST1 antibody is: synthetic peptide directed towards the N-terminal region of Human MAST1. Synthetic peptide located within the following region: TRDPFPDVVHLEEQDSGGSNTPEQDDLSEGRSSKAKKPPGENDFDTIKLI
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 171 kDa
• Gene Name: microtubule associated serine/threonine kinase 1
• Database Link:
  NP_055790
  Q9Y2H9
• Background: MAST1 appears to link the dystrophin/utrophin network with microtubule filaments via the syntrophins. Phosphorylation of DMD or UTRN may modulate their affinities for associated proteins.
• Synonyms: SAST; SAST170
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Bovine: 93%; Rat: 88%; Mouse: 88%; Horse: 81%; Rabbit: 81%; Guinea pig: 75%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase