MAST1 Rabbit Polyclonal Antibody

SKU
TA338071
Rabbit Polyclonal Anti-MAST1 Antibody
  $585.00
5 Days*
Bulk/Customize
Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-MAST1 antibody is: synthetic peptide directed towards the N-terminal region of Human MAST1. Synthetic peptide located within the following region: TRDPFPDVVHLEEQDSGGSNTPEQDDLSEGRSSKAKKPPGENDFDTIKLI
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 171 kDa
Gene Name microtubule associated serine/threonine kinase 1
Database Link
Background MAST1 appears to link the dystrophin/utrophin network with microtubule filaments via the syntrophins. Phosphorylation of DMD or UTRN may modulate their affinities for associated proteins.
Synonyms SAST; SAST170
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Bovine: 93%; Rat: 88%; Mouse: 88%; Horse: 81%; Rabbit: 81%; Guinea pig: 75%
Reference Data
Protein Categories Enzyme: Kinases, Intracellular Proteins, Membrane Proteins
Protein Families Druggable Genome, Protein Kinase
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.