HS747E2A (C22orf31) Rabbit Polyclonal Antibody
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-HS747E2A antibody: synthetic peptide directed towards the middle region of human HS747E2A. Synthetic peptide located within the following region: MKATQQARKRNFISSKSKQPAGHRRPAGGIRESKESSKEKKLTVRQDLED |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Protein A purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 33 kDa |
| Gene Name | chromosome 22 open reading frame 31 |
| Database Link | |
| Background | The gene encoding the hypothetical protein HS747E2A is located on chromosome 22. |
| Synonyms | bK747E2.1; HS747E2A |
| Note | Immunogen Sequence Homology: Human: 100%; Dog: 92%; Pig: 92%; Horse: 92%; Bovine: 92% |
| Reference Data | |
Write Your Own Review
| Product Manuals |
| FAQs |
| SDS |
Related Products
Check items to add to the cart or
![beta Actin (ACTB) Mouse Monoclonal Antibody [Clone ID: OTI1]](https://cdn.origene.com/catalog/product/assets/images/antibody/100/ta811000-3-w.jpg?width=140&height=140&store=america&image-type=small_image)
![GAPDH Mouse Monoclonal Antibody [Clone ID: OTI2D9]](https://cdn.origene.com/catalog/product/assets/images/antibody/100/ta802519-3-w.jpg?width=140&height=140&store=america&image-type=small_image)
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.