HS747E2A (C22orf31) Rabbit Polyclonal Antibody
Product Data | |
Application | WB |
---|---|
Recommended Dilution | WB |
Reactivity | Human |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-HS747E2A antibody: synthetic peptide directed towards the middle region of human HS747E2A. Synthetic peptide located within the following region: MKATQQARKRNFISSKSKQPAGHRRPAGGIRESKESSKEKKLTVRQDLED |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 33 kDa |
Gene Name | chromosome 22 open reading frame 31 |
Database Link | |
Background | The gene encoding the hypothetical protein HS747E2A is located on chromosome 22. |
Synonyms | bK747E2.1; HS747E2A |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 92%; Pig: 92%; Horse: 92%; Bovine: 92% |
Reference Data |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.