SPG21 Rabbit Polyclonal Antibody

SKU TA338043

Rabbit Polyclonal Anti-SPG21 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SPG21 antibody is: synthetic peptide directed towards the C-terminal region of Human SPG21. Synthetic peptide located within the following region: LCRSAEVNLYVQIHLLQFHGTKYAAIDPSMVSAEELEVQKGSLGISQEEQ
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 35 kDa
• Gene Name: spastic paraplegia 21 (autosomal recessive, Mast syndrome)
• Database Link:
  NP_057714
  Q9NZD8
• Background: The protein encoded by this gene was identified by a two-hybrid screen using CD4 as the bait. It binds to the hydrophobic C-terminal amino acids of CD4 which are involved in repression of T cell activation. The interaction with CD4 is mediated by the noncatalytic alpha/beta hydrolase fold domain of this protein. It is thus proposed that this gene product modulates the stimulatory activity of CD4. At least three different transcript variants encoding two different isoforms have been found for this gene.
• Synonyms: ACP33; BM-019; GL010; MAST
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Dog: 93%; Pig: 93%; Sheep: 93%; Rat: 86%; Horse: 86%; Mouse: 86%; Guinea pig: 86%; Rabbit: 79%

Reference Data