SPG21 Rabbit Polyclonal Antibody

CAT#: TA338043

Rabbit Polyclonal Anti-SPG21 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Transient overexpression lysate of spastic paraplegia 21 (autosomal recessive, Mast syndrome) (SPG21), transcript variant 1
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Recombinant protein of human spastic paraplegia 21 (autosomal recessive, Mast syndrome) (SPG21), transcript variant 1, 20 µg
    • 20 ug

USD 867.00

Other products for "SPG21"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-SPG21 antibody is: synthetic peptide directed towards the C-terminal region of Human SPG21. Synthetic peptide located within the following region: LCRSAEVNLYVQIHLLQFHGTKYAAIDPSMVSAEELEVQKGSLGISQEEQ
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 35 kDa
Gene Name spastic paraplegia 21 (autosomal recessive, Mast syndrome)
Background The protein encoded by this gene was identified by a two-hybrid screen using CD4 as the bait. It binds to the hydrophobic C-terminal amino acids of CD4 which are involved in repression of T cell activation. The interaction with CD4 is mediated by the noncatalytic alpha/beta hydrolase fold domain of this protein. It is thus proposed that this gene product modulates the stimulatory activity of CD4. At least three different transcript variants encoding two different isoforms have been found for this gene.
Synonyms ACP33; BM-019; GL010; MAST
Note Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Dog: 93%; Pig: 93%; Sheep: 93%; Rat: 86%; Horse: 86%; Mouse: 86%; Guinea pig: 86%; Rabbit: 79%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.