SIRPG Rabbit Polyclonal Antibody

SKU
TA338033
Rabbit Polyclonal Anti-SIRPG Antibody
  $585.00
5 Days*
Bulk/Customize
Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-SIRPG antibody is: synthetic peptide directed towards the middle region of Human SIRPG. Synthetic peptide located within the following region: MDFSIRISSITPADVGTYYCVKFRKGSPENVEFKSGPGTEMALGAKPSA
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 30 kDa
Gene Name signal regulatory protein gamma
Database Link
Background The protein encoded by this gene is a member of the signal-regulatory protein (SIRP) family, and also belongs to the immunoglobulin superfamily. SIRP family members are receptor-type transmembrane glycoproteins known to be involved in the negative regulation of receptor tyrosine kinase-coupled signaling processes. Alternatively spliced transcript variants encoding different isoforms have been described.
Synonyms bA77C3.1; CD172g; SIRP-B2; SIRPB2; SIRPgamma
Note Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Horse: 85%
Reference Data
Protein Categories CD Markers, Membrane Proteins
Protein Families Druggable Genome, Transmembrane
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.