SIRPG Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-SIRPG antibody is: synthetic peptide directed towards the middle region of Human SIRPG. Synthetic peptide located within the following region: MDFSIRISSITPADVGTYYCVKFRKGSPENVEFKSGPGTEMALGAKPSA |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 30 kDa |
| Gene Name | signal regulatory protein gamma |
| Database Link | |
| Background | The protein encoded by this gene is a member of the signal-regulatory protein (SIRP) family, and also belongs to the immunoglobulin superfamily. SIRP family members are receptor-type transmembrane glycoproteins known to be involved in the negative regulation of receptor tyrosine kinase-coupled signaling processes. Alternatively spliced transcript variants encoding different isoforms have been described. |
| Synonyms | bA77C3.1; CD172g; SIRP-B2; SIRPB2; SIRPgamma |
| Note | Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Horse: 85% |
| Reference Data | |
| Protein Categories | CD Markers, Membrane Proteins |
| Protein Families | Druggable Genome, Transmembrane |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.