START domain containing 7 (STARD7) Rabbit Polyclonal Antibody

SKU TA338027

Rabbit Polyclonal Anti-STARD7 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-STARD7 antibody is: synthetic peptide directed towards the N-terminal region of Human STARD7. Synthetic peptide located within the following region: SINEMKRLEEMSNMFQSSGVQHHPPEPKAQTEGNEDSEGKEQRWEMVMDK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 37 kDa
• Gene Name: StAR related lipid transfer domain containing 7
• Database Link:
  NP_064536
  Q9NQZ5
• Background: Although the function of this gene is not known, its existence is supported by mRNA and EST data. The predicted gene product contains a region similar to the STAR-related lipid transfer (START) domain, which is often present in proteins involved in the cell signaling mediated by lipid binding. Alternatively spliced transcript variants have been described, although some transcripts occur only in cancer cell lines.
• Synonyms: GTT1
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 86%; Dog: 79%; Horse: 79%

Reference Data