VN1R1 Rabbit Polyclonal Antibody

SKU
TA338021
Rabbit Polyclonal Anti-VN1R1 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-VN1R1 antibody is: synthetic peptide directed towards the C-terminal region of Human VN1R1. Synthetic peptide located within the following region: VQHNHSNRLSCRPSQEARATHTIMVLVSSFFVFYSVHSFLTIWTTVVANP
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 38 kDa
Gene Name vomeronasal 1 receptor 1
Database Link
Background Pheromones are chemical signals that elicit specific behavioral responses and physiologic alterations in recipients of the same species. The protein encoded by this gene is similar to pheromone receptors and is primarily localized to the olfactory mucosa. An alternate splice variant of this gene is thought to exist, but its full length nature has not been determined.
Synonyms V1RL1; VNR19I1; ZVNH1; ZVNR1
Note Immunogen Sequence Homology: Human: 100%; Rabbit: 77%
Reference Data
Protein Families Druggable Genome, GPCR, Transmembrane
Write Your Own Review
You're reviewing:VN1R1 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.