VN1R1 Rabbit Polyclonal Antibody

SKU TA338021

Rabbit Polyclonal Anti-VN1R1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-VN1R1 antibody is: synthetic peptide directed towards the C-terminal region of Human VN1R1. Synthetic peptide located within the following region: VQHNHSNRLSCRPSQEARATHTIMVLVSSFFVFYSVHSFLTIWTTVVANP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 38 kDa
• Gene Name: vomeronasal 1 receptor 1
• Database Link:
  NP_065684
  Q9GZP7
• Background: Pheromones are chemical signals that elicit specific behavioral responses and physiologic alterations in recipients of the same species. The protein encoded by this gene is similar to pheromone receptors and is primarily localized to the olfactory mucosa. An alternate splice variant of this gene is thought to exist, but its full length nature has not been determined.
• Synonyms: V1RL1; VNR19I1; ZVNH1; ZVNR1
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 77%

Reference Data

• Protein Families: Druggable Genome, GPCR, Transmembrane