CC2D2A Rabbit Polyclonal Antibody

SKU TA338019

Rabbit Polyclonal Anti-CC2D2A Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CC2D2A antibody is: synthetic peptide directed towards the N-terminal region of Human CC2D2A. Synthetic peptide located within the following region: EDADMGRQNKNSKVRRQPRKKQKPTPFSRACWQILPHLSAGVPLLGWEHP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 14 kDa
• Gene Name: coiled-coil and C2 domain containing 2A
• Database Link:
  NP_065836
  Q9P2K1
• Background: This gene encodes a coiled-coil and calcium binding domain protein that appears to play a critical role in cilia formation. Mutations in this gene cause Meckel syndrome type 6, as well as Joubert syndrome type 9. Alternative splicing results in multiple transcript variants.
• Synonyms: JBTS9; MKS6
• Note: Immunogen Sequence Homology: Human: 100%; Mouse: 92%; Pig: 77%; Guinea pig: 77%

Reference Data