CHMP6 Rabbit Polyclonal Antibody

SKU TA337987

Rabbit Polyclonal Anti-CHMP6 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CHMP6 antibody is: synthetic peptide directed towards the middle region of Human CHMP6. Synthetic peptide located within the following region: VMEGLQFGNECLNKMHQVMSIEEVERILDETQEAVEYQRQIDELLAGSFT
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 23 kDa
• Gene Name: charged multivesicular body protein 6
• Database Link:
  NP_078867
  Q96FZ7
• Background: This gene encodes a member of the chromatin-modifying protein/charged multivesicular body protein family. Proteins in this family are part of the ESCRT-III (endosomal sorting complex required for transport III) which degrades surface receptors, and in biosynthesis of endosomes.
• Synonyms: VPS20
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Dog: 93%; Bovine: 93%

Reference Data

• Protein Pathways: Endocytosis