IL22 RA2 (IL22RA2) Rabbit Polyclonal Antibody

SKU TA337940

Rabbit Polyclonal Anti-IL22RA2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-IL22RA2 antibody is: synthetic peptide directed towards the C-terminal region of Human IL22RA2. Synthetic peptide located within the following region: NITQVNGSLLVILHAPNLPYRYQKEKNVSIEDYYELLYRVFIINNSLEKE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 26 kDa
• Gene Name: interleukin 22 receptor subunit alpha 2
• Database Link:
  NP_443194
  Q969J5
• Background: The protein encoded by this gene is a soluble class II cytokine receptor. This protein has been shown to specifically bind to interleukin 22 (IL22), block the interaction of IL22 with its cell surface receptor, and thus inhibit IL22 activity. This protein functions as an IL22 antagonist, and may be important in the regulation of inflammatory response. Three alternatively spliced transcript variants encoding distinct isoforms have been described.
• Synonyms: CRF2-10; CRF2-S1; CRF2X; IL-22BP; IL-22R-alpha-2; IL-22RA2; ZCYTOR16
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 86%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway