ORAI3 Rabbit Polyclonal Antibody

SKU TA337882

Rabbit Polyclonal Anti-ORAI3 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ORAI3 antibody is: synthetic peptide directed towards the N-terminal region of Human ORAI3. Synthetic peptide located within the following region: GDAGEQAPLNPEGESPAGSATYREFVHRGYLDLMGASQHSLRALSWRRLY
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 31 kDa
• Gene Name: ORAI calcium release-activated calcium modulator 3
• Database Link:
  NP_689501
  Q9BRQ5
• Background: ORAI3 is a key regulator or component of store-operated Ca2+ channel and transcription factor NFAT nuclear import.
• Synonyms: TMEM142C
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Rat: 86%; Mouse: 86%; Guinea pig: 86%; Rabbit: 79%

Reference Data

• Protein Families: Transmembrane