HGSNAT Rabbit Polyclonal Antibody

SKU TA337879

Rabbit Polyclonal Anti-HGSNAT Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HGSNAT antibody is: synthetic peptide directed towards the N-terminal region of Human HGSNAT. Synthetic peptide located within the following region: RALAALLLAASVLSAALLAPGGSSGRDAQAAPPRDLDKKRHAELKMDQAL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 24 kDa
• Gene Name: heparan-alpha-glucosaminide N-acetyltransferase
• Database Link:
  NP_689632
  Q68CP4
• Background: This gene encodes a lysosomal acetyltransferase, which is one of several enzymes involved in the lysosomal degradation of heparin sulfate. Mutations in this gene are associated with Sanfilippo syndrome C, one type of the lysosomal storage disease mucopolysaccaridosis III, which results from impaired degradation of heparan sulfate.
• Synonyms: HGNAT; MPS3C; TMEM76
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 86%; Horse: 82%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Glycosaminoglycan degradation, Lysosome, Metabolic pathways