HOXA1 Rabbit Polyclonal Antibody

SKU TA337826

Rabbit Polyclonal Anti-HOXA1 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HOXA1 antibody: synthetic peptide directed towards the middle region of human HOXA1. Synthetic peptide located within the following region: NLGVSYSHSSCGPSYGSQNFSAPYSPYALNQEADPPRSLSLPRIGDIFSS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 14 kDa
• Gene Name: homeobox A1
• Database Link:
  NP_705873
  P49639
• Background: In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. HOXA1 is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. The encoded protein may be involved in the placement of hindbrain segments in the proper location along the anterior-posterior axis during development.
• Synonyms: BSAS; HOX1; HOX1F
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 93%; Dog: 92%; Pig: 92%; Rat: 92%; Bovine: 92%; Rabbit: 92%; Guinea pig: 92%; Mouse: 86%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors