PIP5KL1 Rabbit Polyclonal Antibody

SKU TA337786

Rabbit Polyclonal Anti-PIP5KL1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PIP5KL1 antibody: synthetic peptide directed towards the middle region of human PIP5KL1. Synthetic peptide located within the following region: VLDYSLLIAFQRLHEDERGPGSSLIFRTARSVQGAQSPEESRAQNRRLLP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 22 kDa
• Gene Name: phosphatidylinositol-4-phosphate 5-kinase like 1
• Database Link:
  NP_775763
  Q5T9C9
• Background: PIP5KL1 may act as a scaffold to localize and regulate type I PI(4)P 5-kinases to specific compartments within the cell, where they generate PI(4,5)P2 for actin nucleation, signaling and scaffold protein recruitment and conversion to PI(3,4,5)P3.
• Synonyms: bA203J24.5; PIPKH
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Dog: 92%; Pig: 85%; Horse: 79%; Bovine: 79%

Reference Data

• Protein Families: Druggable Genome