OriGene Logo

Clavesin 1 (CLVS1) Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA337779
Rabbit Polyclonal Anti-CLVS1 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY406451 Transient overexpression lysate of clavesin 1 (CLVS1) 100 ug
$436.00
TP306628 Recombinant protein of human retinaldehyde binding protein 1-like 1 (RLBP1L1), 20 µg
20 ug
$737.00

View other "Clavesin 1 or NM_173519" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CLVS1 antibody: synthetic peptide directed towards the N terminal of human CLVS1. Synthetic peptide located within the following region: NFKADDPGIKRALIDGFPGVLENRDHYGRKILLLFAANWDQSRNSFTDIL
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 41 kDa
Gene Name clavesin 1
Database Link
Background CLVS1 contains 1 CRAL-TRIO domain. It may be used as a marker for human hepatocellular carcinomas.
Synonyms CRALBPL; RLBP1L1
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79%
Reference Data
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.