PTGES2 Rabbit Polyclonal Antibody

SKU TA337708

Rabbit Polyclonal Anti-PTGES2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PTGES2 antibody is: synthetic peptide directed towards the N-terminal region of Human PTGES2. Synthetic peptide located within the following region: KEVTEFGNKYWLMLNEKEAQQVYGGKEARTEEMKWRQWADDWLVHLISPN
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 21 kDa
• Gene Name: prostaglandin E synthase 2
• Database Link:
  NP_945176
  Q9H7Z7
• Background: The protein encoded by this gene is a membrane-associated prostaglandin E synthase, which catalyzes the conversion of prostaglandin H2 to prostaglandin E2. This protein also has been shown to activate the transcription regulated by a gamma-interferon-activated transcription element (GATE). Multiple transcript variants have been found for this gene.
• Synonyms: C9orf15; GBF-1; GBF1; mPGES-2; PGES2
• Note: Immunogen Sequence Homology: Human: 100%; Mouse: 86%; Dog: 79%; Pig: 79%; Rat: 79%; Bovine: 79%

Reference Data

• Protein Pathways: Arachidonic acid metabolism, Metabolic pathways