PLS1 Rabbit Polyclonal Antibody

SKU TA337685

Rabbit Polyclonal Anti-PLS1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PLS1 antibody: synthetic peptide directed towards the N terminal of human PLS1. Synthetic peptide located within the following region: ISFEEFVSLMQELKSKDISKTFRKIINKREGITAIGGTSTISSEGTQHSY
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 70 kDa
• Gene Name: plastin 1
• Database Link:
  NP_002661
  Q14651
• Background: Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified.
• Synonyms: I-PLASTIN; I isoform; Plastin-1; plastin 1; plastin 1 (I isoform)
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79%

Reference Data