NUBP1 Rabbit Polyclonal Antibody

SKU TA337665

Rabbit Polyclonal Anti-NUBP1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NUBP1 antibody: synthetic peptide directed towards the N terminal of human NUBP1. Synthetic peptide located within the following region: MEEVPHDCPGADSAQAGRGASCQGCPNQRLCASGAGATPDTAIEEIKEKM
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 34 kDa
• Gene Name: nucleotide binding protein 1
• Database Link:
  NP_002475
  P53384
• Background: NUBP1 is a member of the NUBP/MRP subfamily of ATP-binding proteins
• Synonyms: NBP; NBP1; NBP35
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Pig: 92%; Guinea pig: 92%; Dog: 85%; Horse: 85%

Reference Data