HBLD1 (ISCA2) Rabbit Polyclonal Antibody

SKU TA337604

Rabbit Polyclonal Anti-ISCA2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ISCA2 antibody: synthetic peptide directed towards the middle region of human ISCA2. Synthetic peptide located within the following region: RREASSSSPEAGEGQIRLTDSCVQRLLEITEGSEFLRLQVEGGGCSGFQY
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 16 kDa
• Gene Name: iron-sulfur cluster assembly 2
• Database Link:
  NP_919255
  Q86U28
• Background: ISCA2 is involved in the assembly of mitochondrial iron-sulfur proteins. Probably involved in the binding of an intermediate of Fe/S cluster assembly.
• Synonyms: c14_5557; HBLD1; ISA2; MMDS4
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Bovine: 93%; Rabbit: 92%; Dog: 86%; Horse: 79%

Reference Data