C13orf30 (FAM216B) Rabbit Polyclonal Antibody

SKU
TA337594
Rabbit Polyclonal Anti-FAM216B Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-FAM216B antibody: synthetic peptide directed towards the N terminal of human FAM216B. Synthetic peptide located within the following region: MGQNWKRQQKLWNVPQLPFIRVPPSIYDTSLLKALNQGQQRYFYSIMRIY
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 16 kDa
Gene Name family with sequence similarity 216 member B
Database Link
Background The function of this protein remains unknown.
Synonyms C13orf30
Note Immunogen Sequence Homology: Human: 100%; Zebrafish: 90%
Reference Data
Write Your Own Review
You're reviewing:C13orf30 (FAM216B) Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.