Lebercilin (LCA5) Rabbit Polyclonal Antibody

SKU TA337590

Rabbit Polyclonal Anti-LCA5 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LCA5 antibody: synthetic peptide directed towards the N terminal of human LCA5. Synthetic peptide located within the following region: FSLQKLKEISEARHLPERDDLAKKLVSAELKLDDTERRIKELSKNLELST
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 80 kDa
• Gene Name: LCA5, lebercilin
• Database Link:
  NP_859065
  Q86VQ0
• Background: LCA5 is a protein that is thought to be involved in centrosomal or ciliary functions. Mutations in this gene cause Leber congenital amaurosis type V. This gene encodes a protein that is thought to be involved in centrosomal or ciliary functions. Mutations in this gene cause Leber congenital amaurosis type V. Alternative splicing results in two transcript variants.
• Synonyms: C6orf152
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%; Bovine: 92%

Reference Data