ASB6 Rabbit Polyclonal Antibody
Product Data | |
Application | WB |
---|---|
Recommended Dilution | WB |
Reactivity | Human |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ASB6 antibody: synthetic peptide directed towards the middle region of human ASB6. Synthetic peptide located within the following region: LKMAELGLTRAADVLLRHGANLNFEDPVTYYTALHIAVLRNQPDMVELLV |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 46 kDa |
Gene Name | ankyrin repeat and SOCS box containing 6 |
Database Link | |
Background | ASB6 belongs to a family of ankyrin repeat proteins that, along with four other protein families, contain a C-terminal SOCS box motif. Growing evidence suggests that the SOCS box, similar to the F-box, acts as a bridge between specific substrate-binding domains and the more generic proteins that comprise a large family of E3 ubiquitin protein ligases.The protein encoded by this gene belongs to a family of ankyrin repeat proteins that, along with four other protein families, contain a C-terminal SOCS box motif. Growing evidence suggests that the SOCS box, similar to the F-box, acts as a bridge between specific substrate-binding domains and the more generic proteins that comprise a large family of E3 ubiquitin protein ligases. |
Synonyms | FLJ20548; MGC1024 |
Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Zebrafish: 79% |
Reference Data | |
Protein Families | Druggable Genome |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.