PLEKHA7 Rabbit Polyclonal Antibody

SKU TA337552

Rabbit Polyclonal Anti-PLEKHA7 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PLEKHA7 antibody: synthetic peptide directed towards the middle region of human PLEKHA7. Synthetic peptide located within the following region: PESRYQTLPGRGLSGSTSRLQQSSTIAPYVTLRRGLNAESSKATFPRPKS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 127 kDa
• Gene Name: pleckstrin homology domain containing A7
• Database Link:
  NP_778228
  Q6IQ23
• Background: PLEKHA7 is required for zonula adherens biogenesis and maintenance.PLEKHA7 acts via its interaction with KIAA1543/Nezha, which anchors microtubules at their minus-ends to zonula adherens, leading to recruit KIFC3 kinesin to junctional site.
• Synonyms: DKFZp686M22243
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 93%; Bovine: 93%

Reference Data