MCM BP (MCMBP) Rabbit Polyclonal Antibody

SKU TA337428

Rabbit Polyclonal Anti-MCMBP Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-MCMBP antibody is: synthetic peptide directed towards the N-terminal region of Human MCMBP. Synthetic peptide located within the following region: SYTPSRHKRSYEDDDDMDLQPNKQKDQHAGARQAGSVGGLQWCGEPKRLE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 72 kDa
• Gene Name: minichromosome maintenance complex binding protein
• Database Link:
  NP_079110
  Q9BTE3
• Background: This gene encodes a protein which is a component of the hexameric minichromosome maintenance (MCM) complex which regulates initiation and elongation of DNA. Multiple transcript variants encoding different isoforms have been found for this gene.
• Synonyms: C10orf119; MCM-BP
• Note: Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Pig: 93%; Rat: 93%; Bovine: 93%; Rabbit: 86%; Guinea pig: 79%

Reference Data