LRRC48 (DRC3) Rabbit Polyclonal Antibody

SKU TA337422

Rabbit Polyclonal Anti-LRRC48 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-LRRC48 antibody is: synthetic peptide directed towards the C-terminal region of Human LRRC48. Synthetic peptide located within the following region: NIFEYGLKQQEKRKTELDTFSECVREAIQENQEQGKRKIAKFEEKHLSLF
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 45 kDa
• Gene Name: dynein regulatory complex subunit 3
• Database Link:
  NP_112584
  Q9H069
• Background: The function of this protein remains unknown.
• Synonyms: CFAP134; LRRC48
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 93%; Bovine: 93%; Rabbit: 92%; Dog: 86%; Rat: 86%; Pig: 85%; Guinea pig: 85%

Reference Data