LRIT3 Rabbit Polyclonal Antibody

SKU TA337414

Rabbit Polyclonal Anti-LRIT3 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-LRIT3 antibody is: synthetic peptide directed towards the middle region of Human LRIT3. Synthetic peptide located within the following region: TVIQESPEEGVRWSIMSLTGISSKDAGDYKCKAKNLAGMSEAVVTVTVLG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 69 kDa
• Gene Name: leucine-rich repeat, Ig-like and transmembrane domains 3
• Database Link:
  NP_940908
  Q3SXY7
• Background: The function of this protein remains unknown.
• Synonyms: CSNB1F; FIGLER4
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Guinea pig: 93%; Rabbit: 92%; Bovine: 86%

Reference Data

• Protein Families: Transmembrane