RC74 (INTS9) Rabbit Polyclonal Antibody

SKU TA337358

Rabbit Polyclonal Anti-INTS9 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-INTS9 antibody is: synthetic peptide directed towards the C-terminal region of Human INTS9. Synthetic peptide located within the following region: TKDNKHLLQPPPRPAQPTSGKKRKRVSDDVPDCKVLKPLLSGSIPVEQFV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 71 kDa
• Gene Name: integrator complex subunit 9
• Database Link:
  NP_060720
  Q9NV88
• Background: This gene encodes a subunit of the Integrator complex. This protein complex binds the C-terminal domain of RNA polymerase II and likely plays a role in small nuclear RNA processing. The encoded protein has similarities to the subunits of the cleavage and polyadenylation specificity factor complex. Alternatively spliced transcript variants have been described.
• Synonyms: CPSF2L; INT9; RC74
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 93%; Pig: 86%; Rabbit: 86%; Guinea pig: 86%; Dog: 85%; Bovine: 85%; Horse: 79%; Mouse: 77%

Reference Data