FBXL15 Rabbit Polyclonal Antibody

SKU TA337308

Rabbit Polyclonal Anti-FBXL15 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-FBXL15 antibody is: synthetic peptide directed towards the N-terminal region of Human FBXL15. Synthetic peptide located within the following region: PPMEPSGGEQEPGAVRFLDLPWEDVLLPHVLNRVPLRQLLRLQRVSRAFR
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 32 kDa
• Gene Name: F-box and leucine-rich repeat protein 15
• Database Link:
  NP_077302
  Q9H469
• Background: FBXL15 is a substrate recognition component of a (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of SMURF1, thereby acting as a positive regulator of the BMP signaling pathway. It is required for dorsal/ventral pattern formation and bone mass maintenance and also mediates ubiquitination of SMURF2 and WWP2.
• Synonyms: Fbl15; FBXO37; JET; PSD
• Note: Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Rat: 93%; Goat: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 86%

Reference Data

• Protein Families: Druggable Genome