RCOR2 Rabbit Polyclonal Antibody

SKU TA337283

Rabbit Polyclonal Anti-Rcor2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Rcor2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PPEANTKFNSRWTTDEQLLAVQAIRRYGKDFGAIAEVIGNKTLTQVKTFF
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 53 kDa
• Gene Name: REST corepressor 2
• Database Link:
  NP_775858
  Q8IZ40
• Background: Rcor2 may act as a component of a corepressor complex that represses transcription potential.
• Synonyms: RCOR2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 92%; Zebrafish: 86%

Reference Data

• Protein Families: Transcription Factors