ADPGK Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-ADPGK antibody: synthetic peptide directed towards the N terminal of human ADPGK. Synthetic peptide located within the following region: SILHSRNDLEEAFIHFMGKGAAAERFFSDKETFHDIAQVASEFPGAQHYV |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 54 kDa |
| Gene Name | ADP-dependent glucokinase |
| Database Link | |
| Background | ADPGK (EC 2.7.1.147) catalyzes the ADP-dependent phosphorylation of glucose to glucose-6-phosphate and may play a role in glycolysis, possibly during ischemic conditions. ADPGK (EC 2.7.1.147) catalyzes the ADP-dependent phosphorylation of glucose to glucose-6-phosphate and may play a role in glycolysis, possibly during ischemic conditions (Ronimus and Morgan, 2004 PubMed 14975750). supplied by OMIM |
| Synonyms | 2610017G09Rik; ADP-GK |
| Note | Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Mouse: 93%; Pig: 92%; Rat: 92%; Guinea pig: 92%; Horse: 86%; Rabbit: 83%; Dog: 77% |
| Reference Data | |
| Protein Categories | Intracellular Proteins |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.