BTBD14A (NACC2) Rabbit Polyclonal Antibody

SKU TA337259

Rabbit Polyclonal Anti-NACC2 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-BTBD14A antibody: synthetic peptide directed towards the N terminal of human BTBD14A. Synthetic peptide located within the following region: CDVSIVVKGQAFKAHRAVLAASSLYFRDLFSGNSKSAFELPGSVPPACFQ
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 63 kDa
• Gene Name: NACC family member 2
• Database Link:
  NP_653254
  Q96BF6
• Background: cDNA sequence was generated by The National Institutes of Health Mammalian Gene Collection (MGC) Program.
• Synonyms: BEND9; BTBD14; BTBD14A; BTBD31; NAC-2; RBB
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%

Reference Data