RIN3 Rabbit Polyclonal Antibody

SKU TA337253

Rabbit Polyclonal Anti-RIN3 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RIN3 antibody: synthetic peptide directed towards the N terminal of human RIN3. Synthetic peptide located within the following region: AGMFLVRRDSSSKQLVLCVHFPSLNESSAEVLEYTIKEEKSILYLEGSAL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 108 kDa
• Gene Name: Ras and Rab interactor 3
• Database Link:
  NP_079108
  Q8TB24
• Background: RIN3, biochemically characterized as the stimulator and stabilizer for GTP-Rab5, plays an important role in the transport pathway from plasma membrane to early endosomes.
• Synonyms: DKFZp762H1613; FLJ11700; FLJ22439
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Bovine: 93%; Horse: 92%; Rat: 90%; Mouse: 79%; Dog: 77%

Reference Data