C16orf44 (KLHL36) Rabbit Polyclonal Antibody

SKU TA337252

Rabbit Polyclonal Anti-KLHL36 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C16ORF44 antibody: synthetic peptide directed towards the N terminal of human C16ORF44. Synthetic peptide located within the following region: FCCEYLEQEVSEDNYLYLQELASIYSLKRLDAFIDGFILNHFGTLSFTPD
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 70 kDa
• Gene Name: kelch like family member 36
• Database Link:
  NP_079007
  Q8N4N3
• Background: C16orf44 is an open reading frame 44, found in chromosome 16
• Synonyms: C16orf44
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Zebrafish: 83%

Reference Data