C1orf181 (ZNHIT6) Rabbit Polyclonal Antibody

SKU TA337227

Rabbit Polyclonal Anti-ZNHIT6 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FLJ20729 antibody: synthetic peptide directed towards the C terminal of human FLJ20729. Synthetic peptide located within the following region: PISNKYMYFMKNRARRQGINLKLLPNGFTKRKENSTFFDKKKQQFCWHVK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 54 kDa
• Gene Name: zinc finger HIT-type containing 6
• Database Link:
  NP_060423
  Q9NWK9
• Background: TRMT1 is a tRNA(m(2)(2)G(26))dimethyltransferase
• Synonyms: BCD1; C1orf181; NY-BR-75
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 83%

Reference Data