12 Lipoxygenase (ALOX12) Rabbit Polyclonal Antibody

SKU TA336221

Rabbit Polyclonal Anti-ALOX12 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ALOX12 Antibody: synthetic peptide directed towards the C terminal of human ALOX12. Synthetic peptide located within the following region: MGSLPDVRQACLQMAISWHLSRRQPDMVPLGHHKEKYFSGPKPKAVLNQF
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 76 kDa
• Gene Name: arachidonate 12-lipoxygenase, 12S type
• Database Link:
  NP_000688
  P18054
• Background: ALOX12 belongs to the lipoxygenase family. It contains 1 lipoxygenase domain and 1 PLAT domain. It has oxygenase and 14,15-leukotriene A4 synthase activity.
• Synonyms: 12-LOX; 12S-LOX; LOG12
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 93%; Dog: 86%; Rat: 86%; Bovine: 86%; Pig: 79%; Rabbit: 79%; Guinea pig: 79%; Mouse: 77%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Arachidonic acid metabolism, Metabolic pathways