Myosin (MYL4) Rabbit Polyclonal Antibody

SKU TA336193

Rabbit Polyclonal Anti-MYL4 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-MYL4 Antibody: synthetic peptide directed towards the N terminal of human MYL4. Synthetic peptide located within the following region: MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFDPKSVKIDFTA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 21 kDa
• Gene Name: myosin light chain 4
• Database Link:
  NP_001002841
  P12829
• Background: Myosin is a hexameric ATPase cellular motor protein. It is composed of two myosin heavy chains, two nonphosphorylatable myosin alkali light chains, and two phosphorylatable myosin regulatory light chains. This gene encodes a myosin alkali light chain that is found in embryonic muscle and adult atria. Two alternatively spliced transcript variants encoding the same protein have been found for this gene.
• Synonyms: ALC1; AMLC; GT1; PRO1957
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 83%; Bovine: 79%; Horse: 77%

Reference Data