LST 3TM12 (SLCO1B7) Rabbit Polyclonal Antibody

SKU TA336136

Rabbit Polyclonal Anti-LST-3TM12 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-LST-3TM12 Antibody: synthetic peptide directed towards the middle region of human LST-3TM12. Synthetic peptide located within the following region: RAFFGLKVALIFPVLVLLTVFIFVVRKKSHGKDTKVLENERQVMDEANLE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 71 kDa
• Gene Name: solute carrier organic anion transporter family member 1B7 (putative)
• Database Link:
  NP_001009562
  G3V0H7
• Background: The exact function of LST-3TM12 remains unknown.
• Synonyms: LST-3; LST-3TM12; LST3; SLC21A21
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Transmembrane