PTPLAD2 (HACD4) Rabbit Polyclonal Antibody

SKU TA336126

Rabbit Polyclonal Anti-PTPLAD2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PTPLAD2 Antibody: synthetic peptide directed towards the middle region of human PTPLAD2. Synthetic peptide located within the following region: LLHIYVGIESNHLLPRFLQLTERIIILFVVITSQEEVQEKYVVCVLFVFW
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 27 kDa
• Gene Name: 3-hydroxyacyl-CoA dehydratase 4
• Database Link:
  NP_001010915
  Q5VWC8
• Background: PTPLAD2 is a multi-pass membrane protein. It belongs to the PTPLA family. The function of the PTPLAD2 protein remains unknown.
• Synonyms: PTPLAD2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Rabbit: 100%; Rat: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Mouse: 92%

Reference Data

• Protein Families: Transmembrane