PTPLAD2 (HACD4) Rabbit Polyclonal Antibody
Product Data | |
Application | WB |
---|---|
Recommended Dilution | WB |
Reactivity | Human |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-PTPLAD2 Antibody: synthetic peptide directed towards the middle region of human PTPLAD2. Synthetic peptide located within the following region: LLHIYVGIESNHLLPRFLQLTERIIILFVVITSQEEVQEKYVVCVLFVFW |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 27 kDa |
Gene Name | 3-hydroxyacyl-CoA dehydratase 4 |
Database Link | |
Background | PTPLAD2 is a multi-pass membrane protein. It belongs to the PTPLA family. The function of the PTPLAD2 protein remains unknown. |
Synonyms | PTPLAD2 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Rabbit: 100%; Rat: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Mouse: 92% |
Reference Data | |
Protein Families | Transmembrane |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.